SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for E4NE83 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E4NE83
Domain Number 1 Region: 131-235,268-369
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 3.53e-17
Family DPP6 N-terminal domain-like 0.02
Further Details:      
 
Domain Number 2 Region: 37-195
Classification Level Classification E-value
Superfamily Nitrous oxide reductase, N-terminal domain 0.0000942
Family Nitrous oxide reductase, N-terminal domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E4NE83
Sequence length 377
Comment (tr|E4NE83|E4NE83_KITSK) Uncharacterized protein {ECO:0000313|EMBL:BAJ29514.1} KW=Complete proteome; Reference proteome OX=452652 OS=A-0304 / NBRC 14216 / KM-6054) (Streptomyces setae). GN=KSE_37120 OC=Kitasatospora.
Sequence
MSAHASRRSAAVAFVSAITTGTALLLTACDPSAAETGGAAAAAPAAGAPATPAAPAVPAA
PSTTAATTTAPPADSGTDAASEVDADTGAGATPSQPAAPPSGAAPALNLTGGTGLTVSTG
TRYVVMDGGTVDFGTVVRDLAWSPDGKHAAFVDGAGNLQTADPDGGNRVLVARAPSGVTW
SHPTWQVFSPTPDEAAKYLKPKNNLQFTADDHGTLRLLTIPAAGGTNPTQLVLNPFSDEN
AKPLPQTGNLWPNVGGRYAKSVYANRNDGQVYIRDEYLQQNGAAATRGSQPDLSNDGDLV
FVRVVDGHDHLFTKTGGYDGEERDLTPNATVHYTEPAFSPDGKTIAFRGPDGTYTIPTKG
GTPTKVSDTTGLPAYRG
Download sequence
Identical sequences E4NE83
WP_014136820.1.28511 gi|357390629|ref|YP_004905470.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]