SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for E4NND7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E4NND7
Domain Number 1 Region: 20-157
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.38e-23
Family GHMP Kinase, N-terminal domain 0.0044
Further Details:      
 
Weak hits

Sequence:  E4NND7
Domain Number - Region: 229-255
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 0.0106
Family Homoserine kinase 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E4NND7
Sequence length 299
Comment (tr|E4NND7|E4NND7_HALBP) Shikimate kinase {ECO:0000256|HAMAP-Rule:MF_00370} KW=Complete proteome; Reference proteome OX=469382 OS=10706 / PR3). GN=C499_18869 OC=Halogeometricum.
Sequence
MHGRAVALGAGTILNALSTGVGSAFAIDAETTATVELDDSESVRGSVAEDADADTRLIER
CVELAVERYGDDEYGGTVRTESDVPMAAGLKSSSAAANATVLATADALGVEPDREEACRL
GVQAARDVGVTITGAFDDASASMLGGATVTNNDDDELLSREPVEWDVLVWTPDERAYSAD
ADVESCANVAPMAELVAELALDGRYAEAMTVNGLAFSAALDFPTDPAVEAMPHAAGVSLS
GTGPSVVAVAERGSAAHQTESGDVDDGDESPLKRLRDLWAKRDGRTWLTTTRNDGASIR
Download sequence
Identical sequences E4NND7
gi|313126650|ref|YP_004036920.1| WP_006057069.1.71935 WP_006057069.1.94995

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]