SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for E4NR82 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E4NR82
Domain Number 1 Region: 7-189
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.14e-40
Family GHMP Kinase, N-terminal domain 0.00024
Further Details:      
 
Domain Number 2 Region: 194-342
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 8.39e-27
Family Mevalonate kinase 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E4NR82
Sequence length 345
Comment (tr|E4NR82|E4NR82_HALBP) Mevalonate kinase {ECO:0000256|HAMAP-Rule:MF_00217} KW=Complete proteome; Reference proteome OX=469382 OS=10706 / PR3). GN=Hbor_12290 OC=Halogeometricum.
Sequence
MPAESSNMTVSSAPGKVYLFGEHAVVYGEPAVPCAIERRATVSVETREDSRVRVSAPDLS
LDGFTVEYGGNGDERPDVNVSEGLVEAGIEYIDVAVEQARDAANAPNAGFDVTVESDIPL
GAGLGSSAAVVVASIDAATRELGHPLDPEELAARAYRAEYEVQDGQASRADTFCCAVGGA
VRVEGDDCQHIDAPSLPFVVGFDGGAGDTGKLVAGVRSLRDEYDFAADTVESIGDLVRRG
ESVLAEADPTDHPPEDVLAELGRLMDFDHGLLEALGVSSRTLDNMVWAAREAGAHGAKLT
GAGGGGCIVALDETAETETALRYTAECEDVFRAELARDGVRVEDE
Download sequence
Identical sequences E4NR82
gi|313125993|ref|YP_004036263.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]