SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for E4PTL6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E4PTL6
Domain Number 1 Region: 3-117
Classification Level Classification E-value
Superfamily Ribosomal protein L20 2.75e-45
Family Ribosomal protein L20 0.0000357
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E4PTL6
Sequence length 119
Comment (tr|E4PTL6|E4PTL6_MYCLG) 50S ribosomal protein L20 {ECO:0000256|HAMAP-Rule:MF_00382, ECO:0000256|RuleBase:RU000560} KW=Complete proteome OX=880447 OS=Mycoplasma leachii (strain DSM 21131 / NCTC 10133 / N29 / PG50). GN=MSB_A0245 OC=Bacteria; Tenericutes; Mollicutes; Mycoplasmataceae; Mycoplasma.
Sequence
MARVKYGKVTRARRKRWIKLAKGYFGTKKSSYKKAHEQVIRSMAYAFIGRKERKRDFRSL
WIVRINAAVRPEGLSYSTFMHGLKLANININRKMLSELAINNNEEFKKIVKQAKKALNK
Download sequence
Identical sequences E4PTL6
gi|313665131|ref|YP_004047002.1| gi|392388954|ref|YP_005907363.1| WP_013447558.1.23723 WP_013447558.1.53025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]