SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for E4Q6V5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E4Q6V5
Domain Number 1 Region: 2-156
Classification Level Classification E-value
Superfamily RNase III domain-like 9.77e-48
Family RNase III catalytic domain-like 0.00015
Further Details:      
 
Domain Number 2 Region: 108-219
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 6.62e-18
Family Double-stranded RNA-binding domain (dsRBD) 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E4Q6V5
Sequence length 222
Comment (tr|E4Q6V5|E4Q6V5_CALOW) Ribonuclease III {ECO:0000256|HAMAP-Rule:MF_00104} KW=Complete proteome; Reference proteome OX=632518 OS=Caldicellulosiruptor owensensis (strain ATCC 700167 / DSM 13100 / OL). GN=Calow_0972 OC=Caldicellulosiruptor.
Sequence
MEEIEKALGYKFEDKNLLRLALTHKSATHSNKNCYERLEFLGDAALELAVSKYLYVYFPE
LSEGELTNIRAAVVCSQTLSKVAEKLNLKNHIIFGKREKMEKFYENKSILADVLEALFGA
IFIESGFDTVEKIIVNLLKPYIQKAVAGKLFYDYKTKLQEIVQREGQKKIVYKDCEILEK
KYFKSELFIEGKKVSEGYGTSKKEAQQDAAYKFLLEMGEQEE
Download sequence
Identical sequences E4Q6V5
gi|312135000|ref|YP_004002338.1| WP_013411927.1.29544

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]