SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for E4Q830 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E4Q830
Domain Number 1 Region: 83-176
Classification Level Classification E-value
Superfamily Ribosomal protein L6 8.06e-35
Family Ribosomal protein L6 0.0000222
Further Details:      
 
Domain Number 2 Region: 1-82
Classification Level Classification E-value
Superfamily Ribosomal protein L6 6.17e-30
Family Ribosomal protein L6 0.0000564
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E4Q830
Sequence length 182
Comment (tr|E4Q830|E4Q830_CALH1) 50S ribosomal protein L6 {ECO:0000256|HAMAP-Rule:MF_01365, ECO:0000256|RuleBase:RU003870} KW=Complete proteome OX=632292 OS=108). GN=Calhy_1018 OC=Caldicellulosiruptor.
Sequence
MSRIGRKPIDIPSGVDVKIDGNVITVKGPKGTLTRKIHPEMIVKIENNQIIVQRPSDERF
HKALHGLTRTLIANMVEGVTKGYEKVLEVVGIGYRAQKQGKKLILNVGYSHPVEIEEPAG
ITIEVPDQNRIIVKGIDKQQVGNFAANIRKVREPDPYLGKGIKYADEVLRLKEGKAGKGG
KK
Download sequence
Identical sequences E4Q830
gi|312127241|ref|YP_003992115.1| WP_013402932.1.12921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]