SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E4QRP9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E4QRP9
Domain Number 1 Region: 12-108
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 9.68e-26
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E4QRP9
Sequence length 115
Comment (tr|E4QRP9|E4QRP9_BORBG) PTS system, cellobiose-specific IIA component-like protein {ECO:0000313|EMBL:ADQ44807.1} OX=521009 OS=Borrelia burgdorferi 297. GN=Bbu297_B05 OC=Bacteria; Spirochaetes; Spirochaetales; Borreliaceae; Borreliella.
Sequence
MNKKIYSIEELIDKISMPVVAYSGEAKSFLREALEYAKNKEYDKAELTIQESKKSIAKAH
EAHREIIHQSATNPSSVKTPFILIHAEDHLMSAISELSIFEELINVYKIINEIKK
Download sequence
Identical sequences E4QRP9
WP_012622042.1.66939 WP_012622042.1.70456 gi|387825559|ref|YP_005804891.1| gi|219723267|ref|YP_002476680.1|NC_011853 gi|387825559|ref|YP_005804891.1|NC_017395 gi|410683499|ref|YP_006939607.1|NC_018983

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]