SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for E4TNY3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E4TNY3
Domain Number 1 Region: 69-126
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit B, membrane domain 0.00000000667
Family F1F0 ATP synthase subunit B, membrane domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E4TNY3
Sequence length 166
Comment (tr|E4TNY3|E4TNY3_MARTH) F-type ATPase subunit b {ECO:0000256|HAMAP-Rule:MF_01398} KW=Complete proteome; Reference proteome OX=643867 OS=tractuosus). GN=Ftrac_2569 OC=Marivirga.
Sequence
MEQLVNDFSPGLFFMQLFIFGVLLLLLSKFAWKPILNSLKAREGSIADALQSAENAKEEM
AKLQADNQKLLQEARLERDKLLKEATDIANKIKEEAKSDAAKQADKMISDAKNVIEVEKN
AALKEVTTKVAELSLEIAEKLIRKNLSDDKAQKALAEDFMKDLKLN
Download sequence
Identical sequences E4TNY3
WP_013454690.1.33346 gi|313676659|ref|YP_004054655.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]