SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for E4U9Y4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E4U9Y4
Domain Number 1 Region: 403-547
Classification Level Classification E-value
Superfamily Lysozyme-like 2.41e-41
Family Bacterial muramidase, catalytic domain 0.0021
Further Details:      
 
Domain Number 2 Region: 154-273
Classification Level Classification E-value
Superfamily TPR-like 0.00000664
Family Tetratricopeptide repeat (TPR) 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E4U9Y4
Sequence length 550
Comment (tr|E4U9Y4|E4U9Y4_OCEP5) Lytic transglycosylase catalytic {ECO:0000313|EMBL:ADR37298.1} KW=Complete proteome; Reference proteome OX=670487 OS=506). GN=Ocepr_1846 OC=Oceanithermus.
Sequence
MFRRLATLGLLFLAPVWAQLPAPYRAYEQARQAEDAGGLERLLAEPGYVQVLAARALSRM
AALSPSRRLELAERAARFENAAGDWLWVGRLREVLGDAPGAAEAYGKALPEPEAEAALVR
LARAGVRRAYAALYAGRAYEALLDALPAEGEAAWRARALAGLHRYAEALPHFRAWARDSR
EGRLALGRLLLELKRYAEAEAAFRDAGGAAGAFGRGRALEALGRSEAAVRAYLEARTPEA
LWRATALLERAGRAAEALPLYRELATGDSQYADDATLRLWVLARRRGDAALEAWAYARLD
GGLGLLAGRPYPRPPSGGAPPVAAAGAERAEALFAAGREAWAWGEARWWARRYRQEGRSE
QLAAVVAELERWGWWGRALRLLHGLPLRDGGGDLLRLAYPRAYPGIVEAEARAFGLEPEL
LWAVMRVESRFDPEAVSPTGAKGLMQFVAATWSDVARRLGEEGADPFDPEAAVRFGAYYL
RHLLDVCDRELVCALAGYNGGPGYTRRALAAEDGDVWDFLRFQPRDEPREYVERVLWAYQ
AYKALYRAAP
Download sequence
Identical sequences E4U9Y4
WP_013458468.1.73382 gi|313680732|ref|YP_004058471.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]