SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for E5RFG4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E5RFG4
Domain Number 1 Region: 34-76
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000576
Family HLH, helix-loop-helix DNA-binding domain 0.006
Further Details:      
 
Domain Number 2 Region: 119-157
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000009
Family Heme-binding PAS domain 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E5RFG4
Sequence length 157
Comment (tr|E5RFG4|E5RFG4_HUMAN) Aryl hydrocarbon receptor repressor {ECO:0000313|Ensembl:ENSP00000428893} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=AHRR OC=Catarrhini; Hominidae; Homo.
Sequence
MIPPGECTYAGRKRRRPLQKQRPAVGAEKSNPSKRHRDRLNAELDHLASLLPFPPDIISK
LDKLSVLRLSVSYLRVKSFFQVVQEQSSRQPAAGAPSPGDSCPLAGSAVLEGRLLLESLN
GFALVVSAEGTIFYASATIVDYLGFHQTDVMHQNIYD
Download sequence
Identical sequences E5RFG4
ENSP00000428893 ENSP00000428893

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]