SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for E5RI59 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E5RI59
Domain Number 1 Region: 2-98
Classification Level Classification E-value
Superfamily PLP-dependent transferases 0.00000000000000378
Family AAT-like 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E5RI59
Sequence length 121
Comment (tr|E5RI59|E5RI59_HUMAN) Putative aspartate aminotransferase, cytoplasmic 2 {ECO:0000313|Ensembl:ENSP00000429558} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=GOT1L1 OC=Catarrhini; Hominidae; Homo.
Sequence
MLVVVAVNNQQLLCVLSQLEGLAQALWLNPPNTGARVITSILCNPALLGEWKQSLKEVVE
NIMLTKEKVKEKLQLLGTPGSWGHITEQSGTHGYLGLNCKGLGGWCPPFLTFGLYLSIKL
H
Download sequence
Identical sequences E5RI59
ENSP00000429558 ENSP00000429558

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]