SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for E6KSS4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E6KSS4
Domain Number 1 Region: 9-282
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.29e-76
Family Protein kinases, catalytic subunit 0.000000107
Further Details:      
 
Domain Number 2 Region: 527-588
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000667
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.007
Further Details:      
 
Domain Number 3 Region: 463-522
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000068
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.013
Further Details:      
 
Weak hits

Sequence:  E6KSS4
Domain Number - Region: 596-656
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00051
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.011
Further Details:      
 
Domain Number - Region: 389-452
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0115
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E6KSS4
Sequence length 673
Comment (tr|E6KSS4|E6KSS4_9ACTO) Non-specific serine/threonine protein kinase {ECO:0000313|EMBL:EFU60946.1} KW=Complete proteome; Reference proteome OX=888052 OS=Actinomyces sp. oral taxon 180 str. F0310. GN=HMPREF9006_1276 OC=Actinomyces.
Sequence
MAEPMAHRLAGRYEVRSLIGRGGMAEVHLGFDTRLSRVVAIKMLRRDLAQDSIFQARFRR
EAQSAASLNHPNIVAVYDTGEEIIEDAVGRSIAVPYIVMEYVEGHTVKDLISDGTAVPIN
EAVEIVSGVLSALDYSHANHLVHRDIKPGNIMLTSDGKIKVMDFGIARALTDSQATMTQT
NAVVGTAQYLSPEQARGETVDARSDLYSTGVVLFELLTGRPPFKGDSAVAVAYQHVEQIP
PTPSSILSDIPDSLDRVVLKALAKNREDRYPSAAAMLSDLQRVSRGLDVAAPPADSWATE
VLPTSGMGGAQTAATTPMSAVAPRGGGQAMAATSTSLPPVAERADTAEEASKARKRRTVI
IASVVAIALLLIAGSVWALTRRAAAPETVAVPTVVGLSQANAKAQIEAAGFVWELNSEKV
ASDSVEEGSVASTDPAGGTQAEKGSTVRVTISSGPDSVVLPDNLVGMTPEDARKAIEALG
LKWELDSSKVASDTVAEGKVAQTNPSPGSKVKAGQTIRVYLSSGSDEVEVPDLSGMSQDQ
ARSALKAVGLELGNVTSVDSEKDKDRIVAQDPATGTKVKKGATIGVSVSNGKTAQVEIPT
VVGTSSEDAQAQLKALGLNVTVEEVTDNQPAGQVLSIEPGEGSKVEKNSTVKLKVSKGPQ
AGNNGNNGNKKKS
Download sequence
Identical sequences E6KSS4
WP_009212734.1.37461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]