SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for E6N8R9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E6N8R9
Domain Number 1 Region: 49-326
Classification Level Classification E-value
Superfamily SIS domain 5.89e-35
Family double-SIS domain 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E6N8R9
Sequence length 338
Comment (tr|E6N8R9|E6N8R9_9ARCH) Mannose-6-phosphate isomerase / glucose-6-phosphate isomerase {ECO:0000313|EMBL:BAJ48688.1} KW=Complete proteome; Reference proteome OX=311458 OS=Candidatus Caldiarchaeum subterraneum. GN=CSUB_C1540 OC=Candidatus Caldiarchaeum.
Sequence
MSVEEGCEKAWRMVLSSPTMYREGFRKGETHSNTVNPAYVRRIFIAGVGGSGIVGDIISA
IRDHNLPPPVETLKTFRLPGYTGPDTLLIPVSYSGDTVETSWAFVDGFSKSVAVVGVSSG
GRLTSLMEMRGLRVVKVSEGLQPRYAVPEMVGAVYGLLTGFEAFPREKFLQAVDELETYA
KKFSENGLQQMVEQARPMLGRHVVIVSADNLYSAAYRLKCQLNENAKHPCHVATAPEAFH
NEVEGWTNLGNYCYVFLRSGYEQLMVSDGLDWMKEYLRSNGAAVIEIGVKSSSPVSELLK
FLLIADLLSLGLACLKKVDPIMLHTIPKLRPILRRHLP
Download sequence
Identical sequences E6N8R9
gi|557694967|ref|YP_008798021.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]