SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for E6SPI2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E6SPI2
Domain Number 1 Region: 2-230
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 2.86e-64
Family Sir2 family of transcriptional regulators 0.0000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E6SPI2
Sequence length 232
Comment (tr|E6SPI2|E6SPI2_BACT6) Regulatory protein SIR2 homolog {ECO:0000256|HAMAP-Rule:MF_01121} KW=Complete proteome; Reference proteome OX=693979 OS=36-108). GN=Bache_0854 OC=Bacteroides.
Sequence
MKNLVVLSGAGMSAESGISTFRDAGGLWDRYPVEQVATPEGYARDPELVINFYNERRRQL
LDVKPNAGHAGLAELERDFNVTVVTQNVDNLHERAGSTHVIHLHGELTKVCSSRDPYNPH
FIKELKPGEYEVKMGDKAGDGTQLRPFIVWFGEAVPQIETAIRYVEKADIFVIIGTSMNV
YPAAGLLNYVPREADVYLIDPKPVDAHTLRQIHVIRKGASDGVEELISLLRS
Download sequence
Identical sequences E6SPI2
gi|319900729|ref|YP_004160457.1| WP_013546484.1.62754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]