SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for E6SW22 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E6SW22
Domain Number 1 Region: 26-417
Classification Level Classification E-value
Superfamily (Trans)glycosidases 7.9e-103
Family NagZ-like 0.000000983
Further Details:      
 
Domain Number 2 Region: 418-660
Classification Level Classification E-value
Superfamily Beta-D-glucan exohydrolase, C-terminal domain 6.54e-52
Family Beta-D-glucan exohydrolase, C-terminal domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E6SW22
Sequence length 780
Comment (tr|E6SW22|E6SW22_BACT6) Glycoside hydrolase family 3 domain protein {ECO:0000313|EMBL:ADV42547.1} KW=Complete proteome; Reference proteome OX=693979 OS=36-108). GN=Bache_0522 OC=Bacteroides.
Sequence
MNKKLILSLALSGLVLTTAAQTKVTPAIPQDAKMEQQIEKLLKKMTLDEKVGQMCELTID
LLQDRKANPSNGFRLSEAMLDSVIGKYKVGSILNVPNGIAQTPAKWQEIIKRIQEKSIKE
IGIPCVYGVDQIHGTTYTLGGTFFPQGINMGAAFNRELTRRGAEISAYETKAGSIPWTYA
PVTDLGRDPRWPRQWENYGEDCYLNAEMGREAVIGFQGNDPNHIGTRNVAACMKHFMGYG
APVSGKDRTPSSITVQDMREKHFAPYLEMVRNGALSVMVNSAMNNGLPFHANYELLTKWL
KEDLEWDGMIVTDWADIDNLWKRDHIAKDKKEAIKLAINAGIDMSMDPYDWRFCPLLKEL
VQEGEVPMSRIDDAVRRVLRLKYRLNLFEKPYYDLKDFPLFGGKQHAAAALQAAEESLVL
LKNTDAVLPLAKGKKILLTGPNANSMRCLNGGWSYTWQGSNAEACAEPYNTILEAFTNKF
GADHVIYEAGVTYNDKGNWWEENTPQIEKAVAAAAKADYIVACIGENSYCETPGNLTNLF
LSENQLDLVKALAKTGKPVILILSEGRPRIISDIEPLAKAVVDVMLPGNYGGDALANLIA
GDANFSGKLPFTYPKEINSLITYDYKPCEHIGKQMEGAYNYDAQVSVQWAFGYGLSYTTF
AYSNLKVNKPNFSANDELIFTVDVKNTGNCIGKESVLLFSSDLIASLTPDNRRLRAFEKV
ELNPGESKTVTLKLKASDLAFVGYDGKWILEKGDFRIQAGSQVMNVVCTDTKKWETPNKQ
Download sequence
Identical sequences E6SW22
WP_013546163.1.62754 gi|319900405|ref|YP_004160133.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]