SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for E6SWS4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E6SWS4
Domain Number 1 Region: 24-229
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 0.0000203
Family Sir2 family of transcriptional regulators 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E6SWS4
Sequence length 1230
Comment (tr|E6SWS4|E6SWS4_BACT6) Uncharacterized protein {ECO:0000313|EMBL:ADV43626.1} KW=Complete proteome; Reference proteome OX=693979 OS=36-108). GN=Bache_1623 OC=Bacteroides.
Sequence
MNNTLIIMKENIPNNIKHYIVEIADRLWNGHASIMIGAGFSKNAQKTNTSTKSFPTWNEL
GDILYERLHASKPNDNDKAYLNVLKLADEVEVAFGKEYLNNLIKRVIPDNEHIPSGLHIK
MLSLPWKDVFTTNYDTLLERSADLITERRYEIVTNKHDLVWSTSPRIVKLHGSFPSERPF
IVSGEDYRQYPQKYAPFVNTVQQSLLENTLCLVGFSGDDPNFLNWIGWIRDNLGKENSPK
IYLIGILSLSPGQTKLLEERNIISVDLSGYCLDKVDHYEAIDKFITSVNSLNSIKAEDWG
EKDIRHKKDSNKDNYKEVLDQWRKLRQSYPGWLILPSKKRKALIDVTESIWLSKEFISKF
SDPNDLLFLFEFNWRIEKGLHPLLNDWATIYESAVEKYNPFHEKLQIEGAITSEINSKLD
WEQIKNAWIVLQLALLRLYREEGWSDKWHTLSNQFDEIISELSSEQKARYNYERCLQYAY
NFDIIKIKECLTNWTPDMSMPYWESKRATLIAEFDSTAEAVNILESALKEVRARLNLSPI
KNNLSFISMESYIMLLHRCISRADEMRQRLFLFEHNDNYQKRWQNLRLYDCDPWEELKYF
EIEMKSVLNISKTKETIASFDIGRSSTNYKFRSNESFRLAWGYFRFIEEIGLPYHLPYLN
VLDKECFSNAITVISQCSPFSGNVAMIRSGNNKTVSSIYNRVTLSTMNREMVSDHIIRYI
ALLKHTCNVNKEKGGSDNMTHSLSSTLPEIISRLCCKSTYESRVDILGIAKEIYTSGIIE
SYTGINELIKRLVGSFSAEEQYYLIPNLLEFPIYFDRLEKSDYDPFQYIIVINSFRGVEV
DNQVVSKLIAQLLEDNYTRTIAYNRLNVLLSYNLLKPQQIKKIAVNSWKFLNKNGFPTKI
GYYYFAFLGLPHPENIDPIDILRKYITNTPFPINSKKEDESIEFFMGNIPLFNNIAGTYD
YRDQYKWSSDEINKLVSNIIEWWDADKHYLLDKKKHFGPSVSDKFKSRFVWLKRIITTIV
SVNYKFIRELNISLLDKMVKEIPSYNIYNLEIKASLPRLYKDKNELHIKILNAISSDDND
RILDGINAIIELSCGKSNISDLINAITSNFRCGKKEGLGYSIDCICQILSHRKNTFSSLN
IQNIDLGLLYLASHTIVNYDDTESEANEKIDIKRKVARLLVYYKNIINHDSEAYNKWMLI
ITDDDEFAEVKNKYRNTEVMYNHKEVTLKR
Download sequence
Identical sequences E6SWS4
gi|319901484|ref|YP_004161212.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]