SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for E6UAR7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E6UAR7
Domain Number 1 Region: 1-112
Classification Level Classification E-value
Superfamily YheA/YmcA-like 5.23e-18
Family YmcA-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E6UAR7
Sequence length 136
Comment (tr|E6UAR7|E6UAR7_RUMA7) Uncharacterized protein {ECO:0000313|EMBL:ADU22489.1} KW=Complete proteome; Reference proteome OX=697329 OS=2250 / 7). GN=Rumal_1996 OC=Ruminococcus.
Sequence
MNVIELTRQLGKAIQEDERYKKYEAACALNDTDTEIQNEIGKFNQMRQDLSVEMRKPDKD
ADRLTTLDHDIKELYEKIMAMPKMVEYNEAKADIDALMKSVYYILQQSANGEDPETCPAQ
APSGCSGSCSTCGGCG
Download sequence
Identical sequences E6UAR7
WP_013498649.1.49193 WP_013498649.1.63498 gi|317056656|ref|YP_004105123.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]