SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E7FJB9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E7FJB9
Domain Number 1 Region: 7-186
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.19e-36
Family FAD/NAD-linked reductases, N-terminal and central domains 0.00000182
Further Details:      
 
Domain Number 2 Region: 147-306
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.5e-31
Family FAD/NAD-linked reductases, N-terminal and central domains 0.00000582
Further Details:      
 
Domain Number 3 Region: 310-402
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 8.86e-25
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.00000224
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E7FJB9
Sequence length 408
Comment (tr|E7FJB9|E7FJB9_9BURK) Biphenyl dioxygenase ferredoxin reductase subunit {ECO:0000313|EMBL:BAJ72252.1} OX=358220 OS=Acidovorax sp. KKS102. GN=bphA4 OC=Comamonadaceae; Acidovorax.
Sequence
MSQEALKAPVVVLGAGLASVSFVAELRQAGYQGLITVVGDEAERPYDRPPLSKDFMAHGD
AEKIRLDCKRAPEVEWLLGVTAQSFDPQAHTVALSDGRTLPYGTLVLATGAAPRALPTLQ
GATMPVHTLRTLEDARRIQAGLRPQSRLLIVGGGVIGLELAATARTAGVHVSLVETQPRL
MSRAAPATLADFVARYHAAQGVDLRFERSVTGSVDGVVLLDDGTRIAADMVVVGIGVLAN
DALARAAGLACDDGIFVDAYGRTTCPDVYALGDVTRQRNPLSGRFERIETWSNAQNQGIA
VARHLVDPTAPGYAELPWYWSDQGALRIQVAGLASGDEEIVRGEVSLDAPKFTLIELQKG
RIVGATCVNNARDFAPLRRLLAVGAKPDRAALADPATDLRKLAAAVAA
Download sequence
Identical sequences E7FJB9 Q52437
1d7yA WP_043565528.1.5072 WP_043565528.1.71962 WP_043565528.1.80432 1d7y_A 1f3p_A 2gqw_A 2gr0_A 2gr1_A 2gr2_A 2yvf_A 2yvg_A 2yvj_A 2yvj_P

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]