SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for E7LXQ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E7LXQ8
Domain Number 1 Region: 2-181
Classification Level Classification E-value
Superfamily Cyclophilin-like 1.01e-70
Family Cyclophilin (peptidylprolyl isomerase) 0.00000115
Further Details:      
 
Domain Number 2 Region: 217-363
Classification Level Classification E-value
Superfamily TPR-like 3.37e-19
Family Tetratricopeptide repeat (TPR) 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E7LXQ8
Sequence length 371
Comment (tr|E7LXQ8|E7LXQ8_YEASV) Cpr6p {ECO:0000313|EMBL:EGA77744.1} KW=Complete proteome; Reference proteome OX=764099 OS=Saccharomyces cerevisiae (strain VIN 13) (Baker's yeast). GN=VIN13_3268 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MTRPKTFFDISIGGKPQGRIVFELYNDIVPKTAENFLKLCEGNAGMAKTKPDVPLSYKGS
IFHRVIKDFMCQFGDFTNFNGTGGESIYGEKFEDENFTVKHDKPFLLSMANAGPNTNGSQ
AFITCVPTPHLDGKHVVFGEVIQGKRIVRLIENQQCDQENNKPLRDVKIDDCGVLPDDYQ
VPENAEATPTDEYGDNYEDVLKQDEKVDLKNFDTVLKAIETVKNIGTEQFKKQNYSVALE
KYVKCDKFLKEYFPEDLEKEQIEKINQLKVSIPLNIAICALKLKDYKQVLVASSEVLYAE
AADEKAKAKALYRRGLAYYHVNDTDMALNDLEMATTFQPNDAAILKAIHDTKLKRKQQNE
KAKKSLSKMFS
Download sequence
Identical sequences B3RHA5 C7GIU5 C8ZDI0 E7KRU7 E7LXQ8 E7NKR8 G2WJ46 H0GKE5
YLR216C YLR216C YLR216C YLR216C YLR216C YLR216C YLR216C SCRT_04174 YLR216C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]