SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for E8ND29 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E8ND29
Domain Number 1 Region: 12-197
Classification Level Classification E-value
Superfamily Formyltransferase 7.06e-52
Family Formyltransferase 0.0000289
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E8ND29
Sequence length 207
Comment (tr|E8ND29|E8ND29_MICTS) GAR transformylase {ECO:0000256|HAMAP-Rule:MF_01930} KW=Complete proteome; Reference proteome OX=979556 OS=Microbacterium testaceum (strain StLB037). GN=MTES_0704 OC=Microbacterium.
Sequence
MHLRRLTSVLTVAVLISGTGSNLRALLEAAAAPDFPARVVAVGADREADGFAHAEHFGIP
TFLVPFSAFATREEWGAELGAQLAVWNPDLVVLSGMMRLLPADLVAAWEPRIINTHPAYL
PEFPGAHGVRDALAAGVEQTGASVIVVDSGVDTGPILAQERIPVLPGDDEHALHERIKPV
ERRLLIDVVRRIAEGELDLAATASRTA
Download sequence
Identical sequences E8ND29
gi|323357152|ref|YP_004223548.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]