SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for E8R7V4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E8R7V4
Domain Number 1 Region: 6-194
Classification Level Classification E-value
Superfamily Flavoproteins 1.68e-37
Family Hypothetical protein YwqN 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E8R7V4
Sequence length 239
Comment (tr|E8R7V4|E8R7V4_DESM0) NADPH-dependent FMN reductase {ECO:0000313|EMBL:ADV64580.1} KW=Complete proteome OX=765177 OS=O7/1). GN=Desmu_0261 OC=Desulfurococcaceae; Desulfurococcus.
Sequence
MDGKPRILVINGSPRKYGSSMQLSIVAAKGVVDAGGIPEIVSLYDYRIKPCMGCVSDGNK
YCRFPCVIKDDDFNTLAGKLLESHGVIISTPVYWYAPSGVLKNFIDRLTSMEHMIFHKGR
SLLEGKVAGFIATGLDSGVMMAISYLAIVMSSMGAHVIPWSMAYSHLEDITRDEQALRDS
YNVGYIAAKTARALMSYEHIGYNPLVDVKELAELARRYTATEVAERERRIGMLEDLSKD
Download sequence
Identical sequences E8R7V4
gi|320100470|ref|YP_004176062.1| WP_013561802.1.43297 WP_013561802.1.60640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]