SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for E8R8Q8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E8R8Q8
Domain Number 1 Region: 6-224
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.99e-42
Family Extended AAA-ATPase domain 0.0002
Further Details:      
 
Weak hits

Sequence:  E8R8Q8
Domain Number - Region: 234-358
Classification Level Classification E-value
Superfamily post-AAA+ oligomerization domain-like 0.0138
Family DNA polymerase III clamp loader subunits, C-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E8R8Q8
Sequence length 425
Comment (tr|E8R8Q8|E8R8Q8_DESM0) Clamp loader large subunit {ECO:0000256|HAMAP-Rule:MF_01508} KW=Complete proteome OX=765177 OS=O7/1). GN=Desmu_0575 OC=Desulfurococcaceae; Desulfurococcus.
Sequence
MSHQRVPWVIKYRPRTLEEFEDQEEAKEKLIAWLESWEKGVPGKKAALLHGPPGCGKTSL
VEAVARSKGYQLFEMNASDARRKEDIDRIVKLASRSGALTGSRKIILLDEVDGMDPRADA
GGIEALVEVIKATANPIIMTANNPYSQALRPLRELSEVIGFKRLSESVVVKVLKKICGAE
KLFCEDEALREIARRSEGDLRSAINDLEALAGLSGGVTVNAVKELSTYRNRVYAPYEALQ
KLFNARYIFQAKEYATSTDLAPDEFIIWINEHIPTYYEDPEEVARAYDALSRADVYMGRI
VRTQNWDLLSYVLEMMGPGVAFARKTYRYRWKPFKSPERLKLMSEAKRSREIRESLAEQL
SRRLLTSKTVVRSDVIPFLRVIFRHNPKYAAKLAKGYGLPEEVVKWLAGTRGSEILGYMR
KTRTK
Download sequence
Identical sequences E8R8Q8
gi|320100774|ref|YP_004176366.1| WP_013562106.1.43297 WP_013562106.1.60640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]