SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for E8R8R7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E8R8R7
Domain Number 1 Region: 7-188
Classification Level Classification E-value
Superfamily LigT-like 2.09e-41
Family 2'-5' RNA ligase LigT 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E8R8R7
Sequence length 191
Comment (tr|E8R8R7|E8R8R7_DESM0) RNA 2',3'-cyclic phosphodiesterase {ECO:0000256|HAMAP-Rule:MF_01940} KW=Complete proteome OX=765177 OS=O7/1). GN=Desmu_0584 OC=Desulfurococcaceae; Desulfurococcus.
Sequence
MSSELVRSFIAIEVKNRDVLRRLIEARDRVAGVGVDLKPVEDENIHLTLRFIGEVPRSTV
EEVCGIVTGISFKPFEMHVKGIGGFPSLERPRVIWAGIEEGAGELLELYRVVEAGLRRLG
VKPEREEFTPHITLARVKGYRGLEKLVKVLLEMRDMDFGYTPVDEVIVKKSVLTPRGPIY
SNICVKKLVQQ
Download sequence
Identical sequences E8R8R7
gi|320100783|ref|YP_004176375.1| WP_013562115.1.43297 WP_013562115.1.60640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]