SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for E8UXP4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E8UXP4
Domain Number 1 Region: 183-591
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 8.2e-91
Family beta-Lactamase/D-ala carboxypeptidase 0.00031
Further Details:      
 
Domain Number 2 Region: 57-228
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 3.4e-36
Family Penicillin binding protein dimerisation domain 0.0043
Further Details:      
 
Domain Number 3 Region: 716-769
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000000706
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E8UXP4
Sequence length 771
Comment (tr|E8UXP4|E8UXP4_TERSS) Peptidoglycan glycosyltransferase {ECO:0000313|EMBL:ADV81988.1} KW=Complete proteome; Reference proteome OX=401053 OS=Terriglobus saanensis (strain ATCC BAA-1853 / DSM 23119 / SP1PR4). GN=AciPR4_1160 OC=Terriglobus.
Sequence
MSKQPRQTLTAPIRRIRFVWVAFAFLIWTFGISFRLVWLQVYKHKDWVDRAAKQQQRTFE
VAPRRGVLYDRNLRELAVTVLAESVYAVPSELGDNRATAAELLAPIVHVDPTDSFTTEQG
ILGRMNASRNFAWVARKLTPEQATRVRELNLKGVYLQKEFKRFYPNSDLASQVLGYVGTD
DSGLGGLEGKFDDDLHGTPGRVLTALDAKRHAMGSEEREPLPGENLVLSIDTNIQYMAER
ALDKQMEKVKAAHGTVVVQDPNTGQILALAISPRYNPNDLRHQDASILKNLAVSDVYEPG
STFKLVTYSAALDAAGVQPTDIVDCQGGAMTMYGRTLHDDKADHFGRVTVQYALEHSSDV
GAAKMALKVGPNKFYDYIRGFGFGDRSGIELPSETRGLLRAPKKWGATSILSIAIGQEIG
VTPVQLVTMVSTIANGGTYMPPHILLSETEQMKGDPRLRPAAFRPGTRLPEKLPDGAHRV
ISELTSAKMRSMMAGTVIEGSGKAATLNGYSSGGKTGTAQKIDPATHTYSHTKLVASFAG
IAPVSNPAIAIAVVIDTPTLGTRYGSTTSAPVFAEVAQQVLEYLGVPHDQPLHARSKSEI
ASTQKPSGEDDAPSDSGADLGALFAEVNSLPADDPLRAKNDAAMVAASPAPAPTASAPIK
KGMFGALPDKILTAFREHGGSSVMPDSDDQKPLPKSVAQTVTRPDGGVVVSSEKNVPVPT
FVGASMRLVVERARGVGLRVQPVGSGIATEQVPAAGAMVPQGTEVIVRFAR
Download sequence
Identical sequences E8UXP4
WP_013567721.1.63843 gi|320106392|ref|YP_004181982.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]