SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for E8UXT8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E8UXT8
Domain Number 1 Region: 10-67
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.00000123
Family Terminase gpNU1 subunit domain 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E8UXT8
Sequence length 70
Comment (tr|E8UXT8|E8UXT8_TERSS) DNA binding domain protein, excisionase family {ECO:0000313|EMBL:ADV83104.1} KW=Complete proteome; Reference proteome OX=401053 OS=Terriglobus saanensis (strain ATCC BAA-1853 / DSM 23119 / SP1PR4). GN=AciPR4_2310 OC=Terriglobus.
Sequence
MSPLGETPAKFLTAEEAAVHLGCLNSRTVSRWAREGYLPAYALGEGKRRLWRFLLTDLDA
WMRARRTVTA
Download sequence
Identical sequences E8UXT8
WP_013568837.1.63843 gi|320107508|ref|YP_004183098.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]