SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for E8UZ24 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E8UZ24
Domain Number 1 Region: 20-67
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.00000154
Family Terminase gpNU1 subunit domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E8UZ24
Sequence length 88
Comment (tr|E8UZ24|E8UZ24_TERSS) Uncharacterized protein {ECO:0000313|EMBL:ADV80969.1} KW=Complete proteome; Reference proteome OX=401053 OS=Terriglobus saanensis (strain ATCC BAA-1853 / DSM 23119 / SP1PR4). GN=AciPR4_0128 OC=Terriglobus.
Sequence
MNETSGQNNASNSPLEGLQTAPEIAALLRIHPVTLLRWAREGRIPHRRLGSRKIVFIPAE
IADWLRSGAKLYTVSAVRAASTKESEAA
Download sequence
Identical sequences E8UZ24
WP_013566702.1.63843 gi|320105373|ref|YP_004180963.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]