SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for E8UZC6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E8UZC6
Domain Number 1 Region: 2-378
Classification Level Classification E-value
Superfamily Homocysteine S-methyltransferase 1.05e-93
Family Homocysteine S-methyltransferase 0.0000075
Further Details:      
 
Domain Number 2 Region: 330-614
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 1.84e-68
Family Methylenetetrahydrofolate reductase 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E8UZC6
Sequence length 625
Comment (tr|E8UZC6|E8UZC6_TERSS) Homocysteine S-methyltransferase {ECO:0000313|EMBL:ADV82144.1} KW=Complete proteome; Reference proteome OX=401053 OS=Terriglobus saanensis (strain ATCC BAA-1853 / DSM 23119 / SP1PR4). GN=AciPR4_1320 OC=Terriglobus.
Sequence
MKNVAADWLKSRTLLFDGAMGTMFYARGIFINRCYDELNLTEPEMVRELHEEYLMAGAEA
IETNTFGATAPRLARYGLAEKVGAINRAAVVIAHRAVRHAKEKLAVDALVAGSIGPVADA
ALSEDEVRNAYREQMAALVEGEGIDLFAIETVMSLREARLALEAAALAAPGIPSIVMVTV
NEVGQCLDGTEVEEAVRFLEAAGAAAVGCNCSSGPEMILRTIERMRAVTTLPIAGMPNAG
VPSCVDGRSIYLTSPEYMASFARKALRAGATIVGGCCGTTPAHIRSMRGALRAVVAQQEG
TASAGKGTKSDHAVAIVEPMPLAARSLLGGRIARKEFVTMVEIVPPKGIDASRELEGARM
LHAMGVHAINVPDSPRASARMSAGALCIQIQQKIGVEVVLHSTCRDRNLLGLQSDLLGAA
SLGLKNMLCLTGDPPKMGTYPDATAVFDVDAIGQLAMAREMNRGFDIGGNSIGASTNFVL
ACAANPGLPDLDAEVRRFAAKVEAGAEFAITQPVFDLRLLEDFLRRIEQFRIPVIAGIWP
LTSVRNAEFMRNDLKVSVPESIMTRMAACETPESAREEGILIAQEMLREARPQVQGVQVS
APFGKYELAAKVLDGFLSGGGNGDV
Download sequence
Identical sequences E8UZC6
gi|320106548|ref|YP_004182138.1| WP_013567877.1.63843

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]