SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for E8V532 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  E8V532
Domain Number - Region: 32-84
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.000348
Family Terminase gpNU1 subunit domain 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E8V532
Sequence length 95
Comment (tr|E8V532|E8V532_TERSS) Uncharacterized protein {ECO:0000313|EMBL:ADV83719.1} KW=Complete proteome; Reference proteome OX=401053 OS=Terriglobus saanensis (strain ATCC BAA-1853 / DSM 23119 / SP1PR4). GN=AciPR4_2959 OC=Terriglobus.
Sequence
MENRDLHLANSVSDSTAPPRKPPTRWIPVEPLLTAEDVARRLNVSTDWVWDHSSRKKPLL
PVIRMGDGALRYRASGIELFITEHEQIGKLRRRTG
Download sequence
Identical sequences E8V532
gi|320108123|ref|YP_004183713.1| WP_013569451.1.63843

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]