SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for E8WC00 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E8WC00
Domain Number 1 Region: 85-273
Classification Level Classification E-value
Superfamily Rhomboid-like 4.84e-42
Family Rhomboid-like 0.0011
Further Details:      
 
Domain Number 2 Region: 16-46
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000572
Family B-box zinc-binding domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E8WC00
Sequence length 300
Comment (tr|E8WC00|E8WC00_STRFA) Rhomboid family protein {ECO:0000313|EMBL:ADW04615.1} KW=Complete proteome; Reference proteome OX=591167 OS=Streptomyces pratensis (strain ATCC 33331 / IAF-45CD). GN=Sfla_3194 OC=Streptomyces.
Sequence
MDQQPPEDQGGAAAAGGPPTCYRHPGRETGIRCTRCDRPICTDCMIPASVGFQCPDCVRE
GAGTGHHPAASRPRNLAGGSVAADPRLITKILIGINLAVFVGVLAHPALRDDLLLFGRAY
VDERSAGYQGVAEGQWYRLVTSTFLHQEVWHIAFNMLGLWWLGGPLESALGRARYLALYL
LSGLAGSALTYLIADPAQGTLGASGSVFGLLGATAVLMRRMNYDMRPVIALLVVNLIFTF
NPWGGIAWQAHVEGLIAGALIAVAMVHPPRERRKLVQYGACALVFVAVLAVVLVRTAALT
Download sequence
Identical sequences E8WC00
gi|357412396|ref|YP_004924132.1| WP_014155238.1.77427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]