SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for E9B0T9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E9B0T9
Domain Number 1 Region: 387-439
Classification Level Classification E-value
Superfamily HSP33 redox switch-like 0.00000000101
Family HSP33 redox switch-like 0.0027
Further Details:      
 
Domain Number 2 Region: 7-141
Classification Level Classification E-value
Superfamily Hsp33 domain 0.00000000746
Family Hsp33 domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E9B0T9
Sequence length 450
Comment (tr|E9B0T9|E9B0T9_LEIMU) Uncharacterized protein {ECO:0000313|EMBL:CBZ28844.1} KW=Complete proteome OX=929439 OS=Leishmania mexicana (strain MHOM/GT/2001/U1103). GN=LMXM_29_1670 OC=Leishmaniinae; Leishmania.
Sequence
MHVFRTRDITLRVPSKDKLMRFSFCSARHLLAETIRRHDLLRSTGAHLDFLQLLGTQITF
ANLLASALEGEERVEARFTAEEATILTEALALGECRCYLRPEYNAQLAECGLPTFPLRVN
RILYRQEKPFSSVVHADLAELLQPPFGVASNSDAAATRTNEASDAPFSLYLPDMERRVSL
EAWKSFFSYNSSLHAYNYLRRSDGSVPAVWMQSRIDAARLLDHGFLNADGTAAVAGWQRG
EACSDKDEEKKAQDIQRALLHAIPFSFGVLVTPLAAGVAVDQRVSQLNRVVMEAAALLNA
SSGGGATATSALQPLLDQCAERHTACQHILSLVSGDHDGAYEAAVAARQYSDDPMQVAAV
VDPIRRALGVQDFVVPLAATEAARTGLDFFCRCSKQNVMESLVSAPPRALESLKGSDNTV
HCSFCGRRYKLAGAEWQELEMDRSASTPPP
Download sequence
Identical sequences E9B0T9
XP_003877311.1.65987 psu|LmxM29.1670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]