SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for E9B6H6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E9B6H6
Domain Number 1 Region: 242-344
Classification Level Classification E-value
Superfamily TPR-like 0.00000000949
Family Tetratricopeptide repeat (TPR) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E9B6H6
Sequence length 380
Comment (tr|E9B6H6|E9B6H6_LEIMU) Uncharacterized protein {ECO:0000313|EMBL:CBZ30848.1} KW=Complete proteome OX=929439 OS=Leishmania mexicana (strain MHOM/GT/2001/U1103). GN=LMXM_34_2970 OC=Leishmaniinae; Leishmania.
Sequence
MFKASRTLAALLPSLNLGVNKTDFFTSLWSKPQTRDERVKEYVPEVLEESLEQQRAVLEE
STSRDIIVELGNKILQEIDSKSPTPSIAPHLNKLLLQYGVKDVIAQRPLSYLLYPNSSSL
SAGEQVHELVSSFPDNFRAMVEEVERNGCSARTAAYAPAAPEVHVPQAAPSVAAVEHEAT
SDAQVVGSTVASGEAASTVPGGQTPGDGKASSSSQPRADSVIMASKDEYEPMDITMFVKV
AAGMAMANLHCGDMRNAVRCVDAGIAHAKEASRLGGLLALKAGLLVRQKKFVEAAECAKL
AVEASGNIQGYLHGAYALRKLNRPEEAVALLEQGREDHPMNTQLEAQIEAIQKGLKLALP
SSSSSSSASKDAAQEALPAK
Download sequence
Identical sequences E9B6H6
XP_003879293.1.65987 psu|LmxM34.2970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]