SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for E9F4N3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E9F4N3
Domain Number 1 Region: 58-334
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.88e-81
Family Capz beta-1 subunit 0.0000000732
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E9F4N3
Sequence length 336
Comment (tr|E9F4N3|E9F4N3_METRA) Uncharacterized protein {ECO:0000313|EMBL:EFY97215.1} KW=Complete proteome; Reference proteome OX=655844 OS=anisopliae (strain ARSEF 23)). GN=MAA_07232 OC=Metarhizium.
Sequence
MYLPGQFLATAVTCKPQAQVGQSNPAVSEQRAHAQTTTYITITAPLDDTPSFAMAEIDPF
DSALDLLRRLNPKHTASHLNTIISLAPDLAEDLLSSVDAPLTMRRCKQSGREYLLCDYNR
DGDSYRSPWSNQFDPPLDEAGAGGVGADGNEGAGEGAIPSERVRKMEIKANDVFDIYRDL
YYEGGVSSVYLWNLDDGFAGVVLLKKSISPGKSTEGIWDSIHVFEAIERGRMTHYKLTST
VILTLAAAGGSLGDMDLSGNMTRQVEQDMPVDGDDSHIVNVGRLVEDMELKMRNLLQEVY
FGKAKDVVGDLRSVGSLSDGARDREAQRELIGSMRR
Download sequence
Identical sequences A0A0A1UUN9 E9F4N3
XP_007823421.1.8330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]