SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E9FYC4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E9FYC4
Domain Number 1 Region: 90-185
Classification Level Classification E-value
Superfamily PDZ domain-like 1.45e-29
Family PDZ domain 0.0099
Further Details:      
 
Domain Number 2 Region: 11-65
Classification Level Classification E-value
Superfamily L27 domain 4.32e-21
Family L27 domain 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E9FYC4
Sequence length 199
Comment (tr|E9FYC4|E9FYC4_DAPPU) Protein lin-7 homolog {ECO:0000256|PIRNR:PIRNR038039} KW=Complete proteome; Reference proteome OX=6669 OS=Daphnia pulex (Water flea). GN=DAPPUDRAFT_306376 OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
MAATTISEQLSLDKDINRAVELLEKLMKSGEVPTAKLSALHKVLQSDFLRAVREVYEHVY
ETVEMGGSPDVRASATAKATIAAFAASEGHAHPRVVELPKTDEGLGFNVMGGREQNSPIY
ISRIIPGGVADRHGGLKRGDQLLSVNGVSVEGENHEKAVELLKAAHGSVKLVVRYTPKIL
EEMEMRFDKQRTTRRRQPY
Download sequence
Identical sequences E9FYC4
jgi|Dappu1|306376|PASA_GEN_0500031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]