SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for E9IP19 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E9IP19
Domain Number 1 Region: 614-740
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 5.5e-37
Family Regulator of G-protein signaling, RGS 0.0000915
Further Details:      
 
Domain Number 2 Region: 12-93
Classification Level Classification E-value
Superfamily PDZ domain-like 2.1e-20
Family PDZ domain 0.0073
Further Details:      
 
Domain Number 3 Region: 928-1008
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.89e-18
Family Ras-binding domain, RBD 0.007
Further Details:      
 
Domain Number 4 Region: 196-305
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000342
Family Phosphotyrosine-binding domain (PTB) 0.0092
Further Details:      
 
Domain Number 5 Region: 872-938
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000148
Family Ras-binding domain, RBD 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E9IP19
Sequence length 1320
Comment (tr|E9IP19|E9IP19_SOLIN) Uncharacterized protein {ECO:0000313|EMBL:EFZ17750.1} KW=Complete proteome; Reference proteome OX=13686 OS=Solenopsis invicta (Red imported fire ant) (Solenopsis wagneri). GN=SINV_08173 OC=Vespoidea; Formicidae; Myrmicinae; Solenopsis.
Sequence
MHQNRRKKKRVNYGVRAVEVVRGTKGFGFTISGQQPCILSCIVQGSPAESAGLRAGDYLV
AVNGHNVSKVPHDDVVQLIGSSKGILRLQIAENYYSDSSDEEGLATVRSKPKYAHKPRAV
NAGALQLQCRAAKVVRDLQSGAMFHTVPAGLAVPEQTKDQYNYSGLHYRWNMTSPLPPPP
PPVSHKRDSEKIVHRTVVGYLGTIDIPNQLHPSSMMQVLRKCIKRLKAEKRNPTTVLLTI
HVANIKLTNSENRIIAEYPSYRIIFCNSFSEQDKQYFGILTKSMRNTDDIVSNSCHVFTI
YYKLIDHEVHSSACNVFGFMCTKSSQLNVCQEFPDSCTSLIGAIQTLYISDCTNGDTNPY
NEARLRLDAASPQPSNISTSTAHSSNSDSGIGFKDDYGSCSGKNNANDGERRRQYSSNMQ
YRNVSARLSRESVNEAAGHRLTVRAISEARLWNEEIKFDPSEEMRHVAGSGEGTTTTCTG
TSAPVATGRTMLASTSVGSLASVCTTALLDGIEDAAESSKVASTEGLQHLMDTTNKLSPK
VYCGQVTKSLVHSLEDINSSMEYVRPTYCHSYSGKSDKPRPWGSLQEIRNFRSSVSDNCI
YGSTESCDKNNDCKGVHTWASAFEKLLEDPKGLQTFAEFLKKEFSHENIYFWAACERYKD
TKDTAMRHRLACQIYQRHLSNTAAEPVNVDSHASGQITQELLDEAPADLFLQAQKQVFNL
MKFDSYPRFLRSELYRACLEAGSAIVDTEDCDLHLTSSPSIKLKKSHSDAEDRCRKSILP
WNRKNRSKSKDRGEQEYNKAPSRSETIYKSFTVIKRETEGNNNEDSVSISSSRSSLASWD
LALRQSFNKHSVSSCDGQTNEKRDARSKCTGLCRVILPDGSTTVVTTSQTESIKDVVTRL
LDKRALRYSNYDVLILATDEMVDTKCFSSVLAGQEVEVVLTKVLKVELPSRRIISVIAHK
GKTLKEVLRPLLNKYGFNLDLISIWSEGRCVPMDIMAINAPTRITIAANEEDFQRELHTA
KYLDEVPHAQPTLDEITNKVFEELLVGKSRNKYQYSEGSCKSDDQRSEGSSILSSKFFLR
DSTIHGKKKAKSKSCNTSEKGNDCIHEGAPIKSQAPLIAKWRNGVKLQLPGRFDGDDLYE
GLKRAQRSRLEDQRGTEINFELPDFLKNKENGKPSDSKLRRTRVVSANCESTAKFYDSSE
DKQSSSGYEYSAHVTNGTTNERFSALVNITEPLSKCLDNSFTLDGDRTLVDGDQTIVENG
TDSPSKSSHSGSFGSTDLSHTKLSKPPPLPPKPKNLVVNVVKSGYIASPKSLQRPNHVIE
Download sequence
Identical sequences E9IP19
SI2.2.0_08173 XP_011160616.1.47049

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]