SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E9PQR7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E9PQR7
Domain Number 1 Region: 18-112
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 5.56e-34
Family VPS28 N-terminal domain 0.0028
Further Details:      
 
Domain Number 2 Region: 125-161
Classification Level Classification E-value
Superfamily VPS28 C-terminal domain-like 0.00000000000575
Family VPS28 C-terminal domain-like 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E9PQR7
Sequence length 161
Comment (tr|E9PQR7|E9PQR7_HUMAN) Vacuolar protein sorting-associated protein 28 homolog {ECO:0000313|Ensembl:ENSP00000434393} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=VPS28 OC=Catarrhini; Hominidae; Homo.
Sequence
MFHGIPATPGIGAPGNKPELYEEVKLYKNAREREKYDNMAELFAVVKTMQALEKAYIKDC
VSPSEYTAACSRLLVQYKAAFRQVQGSEISSIDEFCRKFRLDCPLAMERIKEDRPITIKD
DKGNLNRCIADVVSLFITVMDKLRLEIRAMDEIQPDLRELM
Download sequence
Identical sequences A0A2J8PXG8 A0A2J8RHS4 E9PQR7
ENSP00000434393 ENSP00000434393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]