SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for E9PW21 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E9PW21
Domain Number 1 Region: 51-501
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.35e-97
Family L-arabinose binding protein-like 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E9PW21
Sequence length 853
Comment (tr|E9PW21|E9PW21_MOUSE) Vomeronasal 2, receptor 74 {ECO:0000313|Ensembl:ENSMUSP00000126917} KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Vmn2r74 OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MFFLNSVFWLLKISFNFGHLSDPRCFWRIKDTENKLGDKETYCFFTISTKHGYVKNDYFR
WNLDKKVTPKTRHLIFSVYLALEEINKNCHILPNISLVVNIECVLDKHDEKTDFLFKSED
LIPNYYCKNERRYLIVLTAPLWAVSSSIGPYLFMSRIPEVSQLYCGHFHLPLSDNEQYPH
LHQISRKDTFLPLAMVSLVVHFRWNWIGVIVTNDDHGIQFLSEFRGEMQNKIVCLSFAII
IKTGKFLAVTELHMNYKQILMSSAKVVIVYGYRDSPIIYAFIVWKSQDLFRIWVSVSQLD
MITFLGDFLLYASTGTFIFSHQKPEISGFEQFIQRIHPSNYSSEFSLAKQWWTYFRCSLP
PSNCKKLKNCSTKTVFKWLFMTPLGLAMSDTCYNIYNAMYAVAHSLHGMLLQQVDTWSKN
AGKELEFDSWKMFSILKTLKFVNPAGDLVNMNQNLKQDVEFDVFYIMDFQKDYGLKMKIG
RFSEHLPSGQQIYMSKEMIEWATDIDQILPSICTMPCRPGLRKSPQEGKDICCFDCKPCS
ENEVSNMTNMDQCVKCPEDQYANEDHTVCLQKVVTILDYRDPLGKALAGFALCFSVLTSL
VLVVFLKHRDTPIVKANNQTLSFVLLISLIFCFICSLLYIGHPTMAICILQQTTFAIVFT
VATSTILSKTVIVILAFKITVPGRRMRWLLESGTPKYIIPICTIIQLILCGIWLGTSPPF
VDADLHMVHGHILIVCNKGSVIAFYCVLGYMGSVALASFTVAFLARNLPDTFNEAKLLTF
SMLVFCSVWITFIPVYHSTKGKTMVAVEVFCILASSAGLLLCIFAPKCYIILLRPQKNYF
YKFRKRRELNLTT
Download sequence
Identical sequences E9PW21
ENSMUSP00000126917 ENSMUSP00000126917 ENSMUSP00000126917 NP_001098657.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]