SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for E9Q1G1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E9Q1G1
Domain Number 1 Region: 33-120
Classification Level Classification E-value
Superfamily ALDH-like 0.00000000000275
Family ALDH-like 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E9Q1G1
Sequence length 121
Comment (tr|E9Q1G1|E9Q1G1_MOUSE) Alpha-aminoadipic semialdehyde dehydrogenase {ECO:0000313|Ensembl:ENSMUSP00000127652} KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Aldh7a1 OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
VQSVKTSKLSGPWSRPAAHMSTLLIHHPQYAWLQDLGLREDNEGVYNGSWGGRGEASLKD
YEETIGKAKKAWNIWADIPAPKRGEIVRKIGDAFREKIQLLGRLVSLEMGKILVEGIGEV
Q
Download sequence
Identical sequences E9Q1G1
ENSMUSP00000127652

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]