SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for E9Q333 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E9Q333
Domain Number 1 Region: 3-124
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 1.83e-25
Family ADP-ribosylglycohydrolase 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E9Q333
Sequence length 135
Comment (tr|E9Q333|E9Q333_MOUSE) [Protein ADP-ribosylarginine] hydrolase-like protein 1 {ECO:0000313|Ensembl:ENSMUSP00000132014} KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Adprhl1 OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MVKRYVETVETLSEHRPDPSTIEGCSQLKPDNYLLAWHTPFSEKGSGFGAATKAMCIGMR
YWKPERLETLIEVSIECGRMTHNHPTGFLGSLCTALFASYALQGKPLVQWGREMLKVLPL
AEEYCRKTIRHMAEY
Download sequence
Identical sequences E9Q333
ENSMUSP00000132014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]