SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for E9Q5P0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E9Q5P0
Domain Number 1 Region: 172-433
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.62e-87
Family Eukaryotic proteases 0.0000000224
Further Details:      
 
Domain Number 2 Region: 79-185
Classification Level Classification E-value
Superfamily SRCR-like 6.93e-16
Family Hepsin, N-terminal domain 0.00000439
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E9Q5P0
Sequence length 445
Comment (tr|E9Q5P0|E9Q5P0_MOUSE) Serine protease hepsin {ECO:0000313|Ensembl:ENSMUSP00000038149} KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Hpn OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MWVGARDDAGHMADEEPGAHRGGSTCSRPQPGKGGRTAACCSRPKVAALIVGTLLFLTGI
GAASWAIVTILLQSDQEPLYQVQLSPGDSRLAVFDKTEGTWRLLCSSRSNARVAGLGCEE
MGFLRALAHSELDVRTAGANGTSGFFCVDEGGLPLAQRLLDVISVCDCPRGRFLTATCQD
CGRRKLPVDRIVGGQDSSLGRWPWQVSLRYDGTHLCGGSLLSGDWVLTAAHCFPERNRVL
SRWRVFAGAVARTSPHAVQLGVQAVIYHGGYLPFRDPTIDENSNDIALVHLSSSLPLTEY
IQPVCLPAAGQALVDGKVCTVTGWGNTQFYGQQAMVLQEARVPIISNEVCNSPDFYGNQI
KPKMFCAGYPEGGIDACQGDSGGPFVCEDSISGTSRWRLCGIVSWGTGCALARKPGVYTK
VTDFREWIFKAIKTHSEASGMVTQP
Download sequence
Identical sequences E9Q5P0
10090.ENSMUSP00000038149 ENSMUSP00000038149 ENSMUSP00000038149 NP_001263198.1.92730 ENSMUSP00000103737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]