SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for E9Q652 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E9Q652
Domain Number 1 Region: 691-838
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.88e-40
Family Regulator of G-protein signaling, RGS 0.0001
Further Details:      
 
Domain Number 2 Region: 1017-1116
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.24e-30
Family Ras-binding domain, RBD 0.00084
Further Details:      
 
Domain Number 3 Region: 227-362
Classification Level Classification E-value
Superfamily PH domain-like 3.16e-23
Family Phosphotyrosine-binding domain (PTB) 0.023
Further Details:      
 
Domain Number 4 Region: 9-98
Classification Level Classification E-value
Superfamily PDZ domain-like 1.33e-20
Family PDZ domain 0.01
Further Details:      
 
Domain Number 5 Region: 962-1031
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.23e-16
Family Ras-binding domain, RBD 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E9Q652
Sequence length 1451
Comment (tr|E9Q652|E9Q652_MOUSE) Regulator of G-protein-signaling 12 {ECO:0000313|Ensembl:ENSMUSP00000084970} KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Rgs12 OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MYRAGEPGKRQPGPAPPRVRSVEVARGRAGYGFTLSGQAPCVLSCVMRGSPADFVGLRAG
DQILAINEINVKKASHEDVVKLIGKCSGVLHMVIAEGTSHVESCSSDEEGGLYEGKGWLR
PKLDSKALGINRAERVVEEVQSGGIFNMIFESSSLCASGPEPLKLKQRSLSESAALRLDA
GQAGLCAPHPSMLSKEDISKVINDDSVFTVGLDSHDDFGLDASILNVAMVVGYLGSIELP
STSSNLEHDSLQAIRGCMRRLRAEQKIHSLVTMKVMHDCVQLVTDRAGVVAEYPAEKLAF
SAVCPDDRRFFGLVTMQTNDDGGLAQEDEGALRTSCHVFMVDPDLFHHKIHQGIARRFGF
ACTADPDTSGCLEFPASSLPVLQFISVLYRDMGELIEGVRARAFLDGDADAHQNNSTSSN
SDSGIGNFNQEEKSNRVLVVDLGGGSSRHGQGSSPGWESGGGRGSQPWSAPWNGAFCHDS
EAGSPLETSPNTDRFWDLTKHSGPVSHMEVPPATLRSSIPPSKRGAAGSSCGFNQRWLPV
HVLQEWQCGHASDQESYTDSTDGWSSVNCGTLPPPMSKIPADRYRVEGSFAQAPLSTQKR
DWSRKAFGMQNLFGPHRNVRKTKEDKKSSKLGRGVALAQTSQRTSARRSFGRSRRFSITR
SLDDLESATVSDGELTGADLKDCISNNSLSSNASLPSVQSCRRLRERRVASWAVSFERLL
QDPVGVRYFSDFLRKEFSEENILFWQACECFSHVPAHDKKELSYRAREIFSKFLCSKATT
PVNIDSQAQLADDILNAPHPDMFKEQQLQIFNLMKFDSYTRFLKSQLYQECVLAEVEGRT
LPDSQQVPSSPASKHSISSDHSNVSTPKKLSGKSKSGRSLNEDVGEEDSEKKRRGAFFSW
SRSRSTGRSQKKKDHGDHAHDAPHANGGLCRRESQGSVSSAGSLDLSEACRTSALEKDKA
AKHCCVHLPDGTSCVVAVKSGFSIKEILSGLCERHGINGAAVDLFLVGGDKPLVLHQDSS
ILATRDLRLEKRTLFRLDLVPINRSVGLKAKPTKPVTEVLRPVVAKYGLDLGSLLVRLSG
EKEPLDLGAPISSLDGQRVILEERDPSRGKVSTDKQKGAPVKQNSAVNSSPRNHLAMGEE
RTLGKSNSIKIRGENGKSARDPRLSKREESIAKIGKKKYQKINLDEAEEFFELISKAQSN
RADDQRGLLRKEDLVLPEFLRLPAGSSELALSSPPPVKGYSKRAVTGHGQEGAAQTEESY
SDSPATSPASAQSPCSAYSPGSAHSPGSAHSTPGPPGTTQPGEKPTKPSCVSMVQEGTTQ
AWRRLSPEMEAGGIQTVEDEQVADLTLMGEGDISSPNSTLLPPPPTPQDTPGPPRPGGGA
RVSGGLPVNRIIDVDLVSGVSPGWGGSILGVQLGPRRVKANGPSLPNGPGLSTIPGEPTK
PKTSTHHATFV
Download sequence
Identical sequences E9Q652
ENSMUSP00000084970 ENSMUSP00000084970 XP_006504183.1.92730 XP_006504184.1.92730 XP_006504185.1.92730 10090.ENSMUSP00000084970 ENSMUSP00000084970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]