SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for E9QQ18 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E9QQ18
Domain Number 1 Region: 702-845,900-964
Classification Level Classification E-value
Superfamily Hemopexin-like domain 1.7e-40
Family Hemopexin-like domain 0.00085
Further Details:      
 
Domain Number 2 Region: 68-107
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000034
Family Somatomedin B domain 0.0011
Further Details:      
 
Domain Number 3 Region: 27-67
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000798
Family Somatomedin B domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E9QQ18
Sequence length 965
Comment (tr|E9QQ18|E9QQ18_MOUSE) Proteoglycan 4 {ECO:0000313|Ensembl:ENSMUSP00000107532} KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Prg4 OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MGWKILPVCLSLLLPVVLIQQVSSQDLSSCAGRCGEGYSRDATCNCDYNCQHYMECCPDF
KRVCTTELSCKGRCFESFARGRECDCDSQCKQYGKCCADYDSFCEEVKDNKKNTPKKKPN
PEPPAVDEAGSGLDNGEFKLTPPPPDPPTTPHSKVTTSPKTTAAKPVTPKPSLAPNSETS
KEASLASNKETTVETKETTATNKQSSASKKKTTSAKETRSAEKTSDKDVEPTSTTPKNSA
PTTTKKPVTTTKEPVPTTPKEPEPTTPKEPPPTTKKPEPTTPKEPEPTTPKEPEPTTPKE
PEPTTPKEPEPTTPKEPPPTTKKPEPTTPKEPEPTTPKEPEPTTTKEPEPTTTKEPESTT
RKEPEPTTPKEPEPTTPKEPEPTTPKEPEPTTPKEPEPTTPKEPEPTTPKEPEPTTPKEP
EPTTPKEPEPTTPKEPEPTTPKEPEPTTPKEPEPTTPKKPEPTTPKEPEPTTPKEPEPTT
PKEPEPTTPKEPEPTTRKEPEPTTPKEPEPTTPKEPEPTTPKKPEPTTTSPKTTTLKATT
LAPKVTAPAEEIQNKPEETTPASEDSDDSKTTLKPQKPTKAPKPTKKPTKAPKKPTSTKK
PKTPKTRKPKTTPSPLKTTSATPELNTTPLEVMLPTTTIPKQTPNPETAEVNPDHEDADG
GEGEKPLIPGPPVLFPTAIPGTDLLAGRLNQGININPMLSDETNLCNGKPVDGLTTLRNG
TLVAFRGHYFWMLNPFRPPSPPRRITEVWGIPSPIDTVFTRCNCEGKTFFFKDSQYWRFT
NDVVDPGYPKQIVKGFGGLTGKIVAALSIAKYKDRPESVYFFKRGGNIQQYTYKQEPMKK
CTGRRPAINYSVYGEAAQVRRRRFERAVGPFQTHTFRIHYSVPMRVSYQDKGFLHNEVKV
STMWRGFPNVVTSAITLPNIRKPDGYDYYAFSKDQYYNIDVPTRTARAITTRSGQTLSKI
WYNCP
Download sequence
Identical sequences E9QQ18
ENSMUSP00000107532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]