SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for E9S728 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E9S728
Domain Number 1 Region: 1-110
Classification Level Classification E-value
Superfamily SpoIIaa-like 4.91e-27
Family Anti-sigma factor antagonist SpoIIaa 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E9S728
Sequence length 112
Comment (tr|E9S728|E9S728_TREDN) Anti-sigma factor antagonist {ECO:0000256|RuleBase:RU003749} KW=Complete proteome OX=699187 OS=Treponema denticola F0402. GN=HMPREF9353_02562 OC=Bacteria; Spirochaetes; Spirochaetales; Spirochaetaceae; Treponema.
Sequence
MELKVRKNKEVYIIDVSGEMDLYNSYRLKELVMKMIERQIKCMIINLEDVDYIDSSGIGA
LIYICSTVKKMNLRLFITNIHGSVKKVIELTKLMGYFPITNSLEEALQKMES
Download sequence
Identical sequences A0A0E2E3W6 A0A0E2ERU0 A0A0F6MN70 E9S728 M2AZ96 M2BXY4 M2SJ19 Q73NN0 S3KNE7
gi|42526632|ref|NP_971730.1| 243275.TDE1122 NP_971730.1.36654 WP_002670686.1.14699 WP_002670686.1.15337 WP_002670686.1.18616 WP_002670686.1.22144 WP_002670686.1.62554 WP_002670686.1.67935 WP_002670686.1.74579 WP_002670686.1.76680 WP_002670686.1.76838 WP_002670686.1.77811 WP_002670686.1.77933 WP_002670686.1.94299 WP_002670686.1.96686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]