SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F0J263 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F0J263
Domain Number 1 Region: 13-488
Classification Level Classification E-value
Superfamily ALDH-like 1.27e-166
Family ALDH-like 0.0000000706
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F0J263
Sequence length 492
Comment (tr|F0J263|F0J263_ACIMA) Succinate-semialdehyde dehydrogenase {ECO:0000313|EMBL:BAJ79649.1} KW=Complete proteome OX=926570 OS=AIU301). GN=ACMV_03020 OC=Acetobacteraceae; Acidiphilium.
Sequence
MLNTTGTVRLKDPALLREANYINGEWVQAESGKTLDVLNPATGELVGRVPAMGAAETRRA
IEAAGRALAGWRAMLAKERAAILRRLYELMMANQDDLGAIMTAEQGKPLAEAKGEIAYAA
GFIEWFAEEGKRIYGDTIPQNAPGRRIIVQKQPIGVFAAVTPWNFPSAMITRKAGPGWAA
GCTGVIRPASQTPFSALALAVLAERAGMPAGVCNIITGPSGPMGAELTANPIVRKFSFTG
STEVGAKLLAQCAPTIKKTSMELGGNAPFIVFDDADLDAAVKGVIDSKFRNAGQTCVCAN
RILVQDGVFELFAEKLKVAVEALKVGNGMEPGVTQGPLINREAVEKVEAHIADAVAGGAR
IVTGGTRHERGGNFFTPTVIADVKHDALIFREETFGPVAPLFRFNTEAEAIAMANDTEFG
LASYFYARDVGRIFRVAEALEYGIVGINEGLISTEVAPFGGVKSSGLGREGSKYGIEDYL
EIKYLALGGLGG
Download sequence
Identical sequences F0J263
gi|326402450|ref|YP_004282531.1| WP_013639292.1.41512 WP_013639292.1.96862

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]