SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F0J5F0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F0J5F0
Domain Number 1 Region: 635-1082
Classification Level Classification E-value
Superfamily ALDH-like 2.36e-120
Family ALDH-like 0.000000233
Further Details:      
 
Domain Number 2 Region: 246-594
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 3.26e-115
Family Proline dehydrohenase domain of bifunctional PutA protein 0.000000000195
Further Details:      
 
Domain Number 3 Region: 76-245
Classification Level Classification E-value
Superfamily N-terminal domain of bifunctional PutA protein 2.22e-61
Family N-terminal domain of bifunctional PutA protein 0.000000978
Further Details:      
 
Domain Number 4 Region: 4-45
Classification Level Classification E-value
Superfamily Ribbon-helix-helix 0.00000117
Family PutA pre-N-terminal region-like 0.0069
Further Details:      
 
Weak hits

Sequence:  F0J5F0
Domain Number - Region: 1110-1222
Classification Level Classification E-value
Superfamily ALDH-like 0.0154
Family ALDH-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F0J5F0
Sequence length 1270
Comment (tr|F0J5F0|F0J5F0_ACIMA) L-glutamate gamma-semialdehyde dehydrogenase {ECO:0000256|PIRNR:PIRNR000197} KW=Complete proteome OX=926570 OS=AIU301). GN=ACMV_08520 OC=Acetobacteraceae; Acidiphilium.
Sequence
MAVSTMGVKLDDQVRARLRALAEREGRTTHHLAKQLILAGLERLERGEALDAAATAEDDA
PAAVPFLEFVQDVQPQTVLRAAITAAYRIPETDAIAGLIEGATLPAAAAKQARATATNLV
TALRARRNAGLVETLLQEYALSSHEGIALMCLAEALLRIPDAATRDALIRDKIGAGDWQS
HLGGNKSVFINAATWGLLLTGRLNATASEAGLSSALTRLLARGGEPVVRRGVNIAMRLMG
EQFVMGRTIGEALANARKREAKGFAYSYDMLGEAALTAADAARYYRDYEQAIHAIGAAAG
GKGIYRGPGISVKLSALHPRYCRAQRARVMEELAPRLKALALLARRYDIGINIDAEEADR
LDLSLDLLEGLCFEPGLAGWNGIGFVVQAYQKRARSVIEFLIDLARRSRHRLMVRLVKGA
YWDSEIKRAQLDGLEGFPVFTRKIHTDLSYLACARAMLAARTEIFPQFATHNALTLASIH
ALAGPAFEVGDYEFQCLHGMGEPLYEEVVGPQKLDRPCRIYAPVGTHETLLAYLVRRLLE
NGANTSFVNRLADRRVPVEALIEDPVAAARKIEPLGAPHPKIALPGAILGTRRNSAGFDL
TSEQRLASLGSALLASLEQDWRAAPPDADPAAPGRAVVNPANIADRVGTVIEPDAGAVGA
ALARAAAMAPIWQATPAAERAAILLRAADLLEHRMTALVGLIVREAGKSLPAAIGEVREA
VDFMRYYAGQLQDGFDNETHRPLGVVAAISPWNFPLAIFTGQVVAALAAGNVVLAKPAEE
TPLIAAQGVRIMHEAGVPADALQLLPGDGRTGAALVEDARVGGVVFTGSTAVARLIQATL
ARRLDADGMPVPLIAETGGQNAMLVDSSALLEQAVGDIVTSAFDSAGQRCSALRILLVQD
DIADPLLAMLRGAMEELAVGATDRLSSDVGPVITREARDNIRAHVETMEGRGHKVFSVAL
PPETEGGWFVAPTMIEIDHPSALEREVFGPVLHVVRYRREERNAMVAAVNALGYALTFGV
HSRIDETIAQAVGKAEAGNIYVNRNIVGAVVGVQPFGGHGLSGTGPKAGGPFYLRRLLAR
RPMAHGEGEPAPAFAKLVGWMREQGIETAPALRYAAASAFRDAELPGPVGEQNTLRLKPK
GLVLCRAASPEGMWRQVAACLATGNAPLVLCDGAEAEIARMPAEIRPAIAPADAVARAEF
RAVLFEGHRDALIALQMALAERDGPIVPVHALPAEDHSEWDYPLEFLLEEQSISVNTAAA
GGNASLMSIG
Download sequence
Identical sequences F0J5F0
gi|326403000|ref|YP_004283081.1| WP_013639657.1.41512 WP_013639657.1.96862

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]