SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F0K1K1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F0K1K1
Domain Number 1 Region: 208-594
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 1.28e-80
Family beta-Lactamase/D-ala carboxypeptidase 0.00000288
Further Details:      
 
Domain Number 2 Region: 65-256
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 4.19e-43
Family Penicillin binding protein dimerisation domain 0.000037
Further Details:      
 
Domain Number 3 Region: 607-662
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000000000013
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0088
Further Details:      
 
Domain Number 4 Region: 665-719
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000000000275
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F0K1K1
Sequence length 720
Comment (tr|F0K1K1|F0K1K1_LACD2) Penicillin-binding protein {ECO:0000313|EMBL:ADY84816.1} KW=Complete proteome OX=353496 OS=Lactobacillus delbrueckii subsp. bulgaricus (strain 2038). GN=LBU_0631 OC=Lactobacillus.
Sequence
MKKTTNLGKIKSRAHGYRFTVGRILELVVALVFLFLAGRMLYLSISKTIDGQDISKRTAA
IYRRNTVLTANRGTIYDKNGLIIAQDSHTYTVYAILDKTYVDSNKKPLYVQDKEKTAEKL
VTVLPLSKAKILKYLNPKNKNTFQVQFGTAGSGLTLTEKKKIQAMHLTGIKFMETPSRLY
PNGVFASNVVGYTVSQNNSKTQTTELEGVTGLEAYFNKILKGTNGYETSMVDSSENQLPS
GFHSYKAAKDGDNLYLTIDSQLQSALETYMSKVQKNYKPKAMTVVIENLKTGKILAASQR
PTFNSQTKAGISEAGSNLLVQSSYEPGSVFKILSLAAAVNSGNYNPKSYYRSGSITVSGS
TIYDWQKSGWGTIPFSQAFPRSSNVGMVYLEKKIGAKLWRKYLNMFRITHKTGITLPGEV
SGSLSFSSPVDQAVTSFGQGVTVNVMQMMQVYSALANNGQMVRPQLVEKITDSSGKTIKS
YRVQKVGKKIFTAQTRKVVMQNMKKVLDKEIGTGHIYYMKGKDFGIKTGTAQIAKSTGGY
MTGDRDYVFSVVGITPTANPRYCIYLTMKQPSKLGSGAETILAQIFKPMMSRLVLLNKGD
KSASAVVKVPKFTGMTYAKAKKTATSNGLSLVRLGTGSKVLSQKAGAGETVSVGSTVFVL
TSRKISLPDLTGWSESQIEAYASLAGIKLQLSGSGKVKSQSLAQGTVVKSGTKLKVELKE
Download sequence
Identical sequences A0A219D3E2 F0K1K1 G6F6J8
WP_003623528.1.101236 WP_003623528.1.15974 WP_003623528.1.17168 WP_003623528.1.33988 WP_003623528.1.96184 gi|385815449|ref|YP_005851840.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]