SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F0K375 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F0K375
Domain Number 1 Region: 9-264
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.23e-84
Family Protein kinases, catalytic subunit 0.00000215
Further Details:      
 
Weak hits

Sequence:  F0K375
Domain Number - Region: 506-566
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000641
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0095
Further Details:      
 
Domain Number - Region: 424-477
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00772
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.012
Further Details:      
 
Domain Number - Region: 355-416
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0127
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F0K375
Sequence length 668
Comment (tr|F0K375|F0K375_LACD2) Serine-threonine protein kinase {ECO:0000313|EMBL:ADY85390.1} KW=Complete proteome OX=353496 OS=Lactobacillus delbrueckii subsp. bulgaricus (strain 2038). GN=LBU_1205 OC=Lactobacillus.
Sequence
MINKGYLLGDRYRIVDTLGEGGMANVYLADDIILKRQVAVKIIRLDLQKDSQVLARFQRE
ALATSELSHPNIVSVFDVGTDHGLPYMVMEYVKGPDLKEYIREKSPIPLPQVIKIMDQIL
SAMELAHKHNVIHRDLKPQNILMDEKGNIKIADFGIAVALNQSAITQTNSVLGSVHYMSP
EQTRGGMVTKQSDIYSLGIILYEALTGHVPFNGETPVAIALKHAEDDIPSLRKQNKAIPQ
ALENVVLKATAKDPRDRYASVAEMKADLDSSLDPSRAGEAIYRPSHGNNDETKILPALNG
KVMQAEKAKEGKAEEPKKRSFCASIKKYKWWWIGSLFPVFAILLFMFLAVGHNNVRVPDV
VNMTEKAAKTSLKSSGLAVGAVKRTYSSDVKKGKVISTTPKANSPVDKGGKVNLLVSKGS
NLTKVPDVEGLYLSTAKKKLNKLGFKVKSREAPSNEYLPGLIISQSVKAGRKVDASKTTI
TLVVAVALEDQPKPSSSSSSKKATFKLADLTGKSLEDAQSYAKSKKLNVKVEKDHSDSVD
SGDVISTDPAAGSEVSEGDTLTITVSKGAEQKEVKKTFTVDYQAAESSSSSSESSSSSSS
SQGNHVRIYIQDDNHSLGNIYRDLYITKDTDFTITFSVTKGDGKIKIVRDDQTVVDETIS
ADDSESGN
Download sequence
Identical sequences F0K375
gi|385816023|ref|YP_005852414.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]