SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F0NIG7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F0NIG7
Domain Number 1 Region: 17-145
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.000000000000106
Family GHMP Kinase, N-terminal domain 0.0054
Further Details:      
 
Domain Number 2 Region: 208-251
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 0.00000863
Family Homoserine kinase 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F0NIG7
Sequence length 268
Comment (tr|F0NIG7|F0NIG7_SULIR) Shikimate kinase {ECO:0000256|HAMAP-Rule:MF_00370} KW=Complete proteome OX=930945 OS=Sulfolobus islandicus (strain REY15A). GN=SiRe_1690 OC=Sulfolobus.
Sequence
MQTYGGVSIINALPSWYGSSMAVNLKVKVEIKEGKRDYSKESDLIRVIIDYFKEKYSIPD
IVVDIESELPQKSGLKSSSAVSVALIAEIAKRYNLRNINPPVLSAILSLKAGVSYTGALD
DATASYCGGIAFTYNKMFRIVKLDNSEDDLSVLILARGGRQKSVNLNELRKYNHVFEEIF
RIALKDSLTAMKINGILIANILGYPLDPIEIALKNGALAAGISGNGPSYFAVSRYGEEGP
IYESLKRFGDVIIARPVSLDCKDLSIRD
Download sequence
Identical sequences F0NIG7 F0NRG7
WP_014512824.1.27011 WP_014512824.1.67233 gi|385776400|ref|YP_005648968.1| gi|385773765|ref|YP_005646332.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]