SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F0QWN1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F0QWN1
Domain Number 1 Region: 4-107
Classification Level Classification E-value
Superfamily GlnB-like 3.41e-38
Family Divalent ion tolerance proteins CutA (CutA1) 0.0000914
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F0QWN1
Sequence length 109
Comment (tr|F0QWN1|F0QWN1_VULM7) Periplasmic divalent cation tolerance protein {ECO:0000313|EMBL:ADY02248.1} KW=Complete proteome OX=985053 OS=Vulcanisaeta moutnovskia (strain 768-28). GN=VMUT_2051 OC=Thermoproteaceae; Vulcanisaeta.
Sequence
MDEDSYIVVLVTVPNRDVGVEIARSLINNKLAACVNVIDGLRSIYYWEGRVEENNETLLI
IKSRRDRLNDLVRYIRERHPYKVPEIIALPIIGGLDDYLRWIGETLNRD
Download sequence
Identical sequences F0QWN1
WP_013605409.1.51010 gi|325969558|ref|YP_004245750.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]