SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F0S3V7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F0S3V7
Domain Number 1 Region: 1-286
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 1.84e-64
Family Methylenetetrahydrofolate reductase 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F0S3V7
Sequence length 295
Comment (tr|F0S3V7|F0S3V7_DESTD) Methylenetetrahydrofolate reductase {ECO:0000256|RuleBase:RU003862} KW=Complete proteome; Reference proteome OX=868864 OS=Desulfurobacterium thermolithotrophum (strain DSM 11699 / BSA). GN=Dester_0889 OC=Desulfurobacterium.
Sequence
MSFSKKIKNGKFIITAEVAPPRGIEWKTVIESIEPLKGKVDAFNVTDNQRSMVRMSSLAM
SKLLLDSGFEPIFQLTCRDRNRIALQSELLGAAALGIKNVCLMTGDFTTLGDQPDAKPVF
DIDSIHLIQTAKKLESGVLLNGKELKGVPNFTVGAVYNPFAGPKVLQVWKLRKKIEAGAE
FIQTQPVYDVRVAKDVHDLIESLGAIPIIGLLPIKSLKMANFMKKLNPTSIPNRLIEGLE
RANNPAQYGWDYVIDIAHAIAEFGKGIHFMLVGKTAELAAFIDYLRNNSPYNHKF
Download sequence
Identical sequences F0S3V7
gi|325295074|ref|YP_004281588.1| WP_013638482.1.33556

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]