SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F0S403 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F0S403
Domain Number 1 Region: 2-187
Classification Level Classification E-value
Superfamily SIS domain 2.89e-53
Family mono-SIS domain 0.00000815
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F0S403
Sequence length 201
Comment (tr|F0S403|F0S403_DESTD) Sedoheptulose 7-phosphate isomerase {ECO:0000256|HAMAP-Rule:MF_00067} KW=Complete proteome; Reference proteome OX=868864 OS=Desulfurobacterium thermolithotrophum (strain DSM 11699 / BSA). GN=Dester_0936 OC=Desulfurobacterium.
Sequence
MKELIYYSFLESADLKRAFVEANRDLIYNVFLEIAKRVKNGKKILLCGNGGSAADCQHIA
AELVGRFGMERRALPAIALTTDTSILTALGNDYSFDRIFERQVEALGEEGDVLIGISTSG
NSKNVINAVKKAKEKKLLTVGFLGKDGGELLKVVDHCFVVKSFSTPRIQEVHITLGHILC
DFIEKYLFSYDNYFPPLGEMI
Download sequence
Identical sequences F0S403
gi|325295120|ref|YP_004281634.1| WP_013638527.1.33556

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]